Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0397 protein SAUSA300_2618(SAUSA300_2618)

Recombinant Staphylococcus aureus UPF0397 protein SAUSA300_2618(SAUSA300_2618)

SKU:CSB-CF640997SKZ

Regular price ¥273,500 JPY
Regular price Sale price ¥273,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300)

Uniprot NO.:Q2FDH6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE

Protein Names:Recommended name: UPF0397 protein SAUSA300_2618

Gene Names:Ordered Locus Names:SAUSA300_2618

Expression Region:1-184

Sequence Info:full length protein

View full details