Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0397 protein SAOUHSC_03020(SAOUHSC_03020)

Recombinant Staphylococcus aureus UPF0397 protein SAOUHSC_03020(SAOUHSC_03020)

SKU:CSB-CF639254FLF

Regular price ¥273,100 JPY
Regular price Sale price ¥273,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain NCTC 8325)

Uniprot NO.:Q2FUT1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE

Protein Names:Recommended name: UPF0397 protein SAOUHSC_03020

Gene Names:Ordered Locus Names:SAOUHSC_03020

Expression Region:1-184

Sequence Info:full length protein

View full details