Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533(SAB0533)

Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533(SAB0533)

SKU:CSB-CF652185SKU

Regular price ¥261,600 JPY
Regular price Sale price ¥261,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain bovine RF122 / ET3-1)

Uniprot NO.:Q2YS64

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGTITPIGGVLFIIGWIMLIIATFKF AG

Protein Names:Recommended name: UPF0382 membrane protein SAB0533

Gene Names:Ordered Locus Names:SAB0533

Expression Region:1-122

Sequence Info:full length protein

View full details