Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0344 protein SAB0838(SAB0838)

Recombinant Staphylococcus aureus UPF0344 protein SAB0838(SAB0838)

SKU:CSB-CF653709SKU

Regular price ¥262,600 JPY
Regular price Sale price ¥262,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain bovine RF122 / ET3-1)

Uniprot NO.:Q2YWW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLMLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PLSKLFGIG

Protein Names:Recommended name: UPF0344 protein SAB0838

Gene Names:Ordered Locus Names:SAB0838

Expression Region:1-129

Sequence Info:full length protein

View full details