Skip to product information
1 of 1

GeneBio Systems

Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R), partial

Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R), partial

SKU:Q2FV99

Regular price ¥151,300 JPY
Regular price Sale price ¥151,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Microbiology

Uniprot ID: Q2FV99

Gene Names: srtA

Alternative Name(s): Surface protein sorting A

Abbreviation: Recombinant Staphylococcus aureus srtA protein, partial

Organism: Staphylococcus aureus (strain NCTC 8325)

Source: Yeast

Expression Region: 25-206aa(P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R)

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISIAGHTFIGRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVGVLDEQKGKDKQLTLITCDDLNRETGVWETRKIFVATEVK

MW: 22.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Transpeptidase that anchors surface proteins to the cell wall . Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal.

Reference:

Function:

View full details