Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2(mnhF2)

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2(mnhF2)

SKU:CSB-CF763952SKW

Regular price ¥257,100 JPY
Regular price Sale price ¥257,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MSSA476)

Uniprot NO.:Q6GBK2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Protein Names:Recommended name: Putative antiporter subunit mnhF2 Alternative name(s): Mrp complex subunit F2 Putative NADH-ubiquinone oxidoreductase subunit mnhF2

Gene Names:Name:mnhF2 Synonyms:mrpF2 Ordered Locus Names:SAS0594

Expression Region:1-100

Sequence Info:full length protein

View full details