
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain MRSA252)
Uniprot NO.:Q6GJ45
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSNKSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
Protein Names:Recommended name: Putative antiporter subunit mnhC2 Alternative name(s): Mrp complex subunit C2 Putative NADH-ubiquinone oxidoreductase subunit mnhC2
Gene Names:Name:mnhc2 Synonyms:mrpC2 Ordered Locus Names:SAR0632
Expression Region:1-114
Sequence Info:full length protein
You may also like
-
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)
- Regular price
- ¥165,800 JPY
- Sale price
- ¥165,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)
- Regular price
- ¥165,800 JPY
- Sale price
- ¥165,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)
- Regular price
- ¥165,800 JPY
- Sale price
- ¥165,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)
- Regular price
- ¥165,800 JPY
- Sale price
- ¥165,800 JPY
- Regular price
-
- Unit price
- per
Sold out