Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Protein msa(msa)

Recombinant Staphylococcus aureus Protein msa(msa)

SKU:CSB-CF641039SKZ

Regular price ¥228,100 JPY
Regular price Sale price ¥228,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300)

Uniprot NO.:Q2FH37

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI VLYYLKKQVKHKI

Protein Names:Recommended name: Protein msa Alternative name(s): Modulator of sarA

Gene Names:Name:msa Ordered Locus Names:SAUSA300_1294

Expression Region:1-133

Sequence Info:full length protein

View full details