Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4(qoxD)

SKU: CSB-CF753514SKV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MRSA252)

Uniprot NO.:Q6GI26

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFIQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Protein Names:Recommended name: Probable quinol oxidase subunit 4 EC= 1.10.3.- Alternative name(s): Quinol oxidase polypeptide IV

Gene Names:Name:qoxD Ordered Locus Names:SAR1031

Expression Region:1-96

Sequence Info:full length protein