Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA(sepA)

Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA(sepA)

SKU:CSB-CF414637SUK

Regular price ¥267,800 JPY
Regular price Sale price ¥267,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain Mu3 / ATCC 700698)

Uniprot NO.:A7X534

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIVNYLKHKFYNLLTTMIVLFIFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMY DNLLYYGSYIIFGYFIIFAVEHLMDYFRKMLPENAYFRGATFHLISYTVATTLFYFIIHL NYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK

Protein Names:Recommended name: Multidrug resistance efflux pump sepA Alternative name(s): Antiseptic resistance protein sepA Staphylococcal efflux pump A

Gene Names:Name:sepA Ordered Locus Names:SAHV_2151

Expression Region:1-157

Sequence Info:full length protein

View full details