Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel(mscL)

CSB-CF654431SKU

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain bovine RF122 / ET3-1)

Uniprot NO.:Q2YXW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:SAB1205c

Expression Region:1-120

Sequence Info:full length protein