Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Holin-like protein CidB(cidB)

Recombinant Staphylococcus aureus Holin-like protein CidB(cidB)

SKU:CSB-CF351540SUL

Regular price ¥272,600 JPY
Regular price Sale price ¥272,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MW2)

Uniprot NO.:P60640

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY

Protein Names:Recommended name: Holin-like protein CidB

Gene Names:Name:cidB Ordered Locus Names:MW2461

Expression Region:1-229

Sequence Info:full length protein

View full details