Gene Bio Systems
Recombinant Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO)
Recombinant Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO)
SKU:CSB-CF860422SKX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain Mu50 / ATCC 700699)
Uniprot NO.:Q99R72
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GTRIPDKYFRQKYIIFKSFNFEKHGKFWNKWFYVRKWKHKILDGHQLNQNIYDQRHLMTI NTDEIEKMIIETKRAELIHWISILPVIIFNKGSRLVKYINIFYAMIANVPIIIVQRYNRP RLTQLLRILKRRGERHD
Protein Names:Recommended name: Glycosyl-4,4'-diaponeurosporenoate acyltransferase EC= 2.3.1.-
Gene Names:Name:crtO Ordered Locus Names:SAV2565
Expression Region:29-165
Sequence Info:full length protein
