
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: entH
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Staphylococcus aureus
Delivery time: 3-7 business days
Uniprot ID: P0A0M0
AA Sequence: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV
Tag info: N-terminal 6xHis-tagged
Expression Region: 25-241aa
Protein length: Full Length of Mature Protein
MW: 27.1 kDa
Alternative Name(s): SEH
Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Reference: "The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules."Haekansson M., Petersson K., Nilsson H., Forsberg G., Bjoerk P., Antonsson P., Svensson L.A.J. Mol. Biol. 302:527-537(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Staphylococcus aureus Enterotoxin type H(entH)
- Regular price
- ¥133,100 JPY
- Sale price
- ¥133,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type D(entD)
- Regular price
- ¥121,300 JPY
- Sale price
- ¥121,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type A(entA),partial
- Regular price
- ¥121,300 JPY
- Sale price
- ¥121,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type E(entE)
- Regular price
- ¥71,300 JPY
- Sale price
- ¥71,300 JPY
- Regular price
-
- Unit price
- per
Sold out