Recombinant Staphylococcus aureus Chemotaxis inhibitory protein(chp)

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein(chp)

CSB-YP746696SKV
Regular price
¥133,800 JPY
Sale price
¥133,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: chp

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Staphylococcus aureus (strain MRSA252)

Delivery time: 3-7 business days

Uniprot ID: Q6GFB3 

AA Sequence: FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Tag info: N-terminal 6xHis-tagged

Expression Region: 29-149aa

Protein length: Full length of mature protein 

MW: 16.1 kDa

Alternative Name(s): CHIPS

Relevance: Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium

Reference: "Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Staphylococcus aureus Chemotaxis inhibitory protein(chp)
    Regular price
    ¥133,800 JPY
    Sale price
    ¥133,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Clumping factor A(clfA)
    Regular price
    ¥104,400 JPY
    Sale price
    ¥104,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial
    Regular price
    ¥121,900 JPY
    Sale price
    ¥121,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Clumping factor B(clfB) ,partial
    Regular price
    ¥121,900 JPY
    Sale price
    ¥121,900 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share