
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: chp
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Staphylococcus aureus (strain MRSA252)
Delivery time: 3-7 business days
Uniprot ID: Q6GFB3
AA Sequence: FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Tag info: N-terminal 6xHis-tagged
Expression Region: 29-149aa
Protein length: Full length of mature protein
MW: 16.1 kDa
Alternative Name(s): CHIPS
Relevance: Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium
Reference: "Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Staphylococcus aureus Chemotaxis inhibitory protein(chp)
- Regular price
- ¥133,800 JPY
- Sale price
- ¥133,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Clumping factor A(clfA)
- Regular price
- ¥104,400 JPY
- Sale price
- ¥104,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial
- Regular price
- ¥121,900 JPY
- Sale price
- ¥121,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Clumping factor B(clfB) ,partial
- Regular price
- ¥121,900 JPY
- Sale price
- ¥121,900 JPY
- Regular price
-
- Unit price
- per
Sold out