Recombinant Staphylococcus aureus Alpha-hemolysin(hly)

Recombinant Staphylococcus aureus Alpha-hemolysin(hly)

CSB-YP639324FLF
Regular price
¥136,000 JPY
Sale price
¥136,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: hly

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Staphylococcus aureus (strain NCTC 8325)

Delivery time: 3-7 business days

Uniprot ID: Q2G1X0

AA Sequence: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Tag info: N-terminal 6xHis-tagged

Expression Region: 27-319aa

Protein length: Full Length

MW: 35.3 kDa

Alternative Name(s): Alpha-toxin

Relevance: Alpha-toxin binds to the mbrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity .

Reference: Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.Sibbald M.J., Winter T., van der Kooi-Pol M.M., Buist G., Tsompanidou E., Bosma T., Schafer T., Ohlsen K., Hecker M., Antelmann H., Engelmann S., van Dijl J.M.J. Bacteriol. 192:3788-3800(2010)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Staphylococcus aureus Alpha-hemolysin(hly)
    Regular price
    ¥123,900 JPY
    Sale price
    ¥123,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Alpha-hemolysin(hly)
    Regular price
    ¥136,000 JPY
    Sale price
    ¥136,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Gamma-hemolysin component C (hlgC)
    Regular price
    ¥99,000 JPY
    Sale price
    ¥99,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Phospholipase C(hlb)
    Regular price
    ¥119,700 JPY
    Sale price
    ¥119,700 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share