Skip to product information
1 of 1

Gene Bio Systems

Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF43(ORF43)

Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF43(ORF43)

SKU:CSB-CF612317SBAI

Regular price ¥282,100 JPY
Regular price Sale price ¥282,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spodoptera frugiperda ascovirus 1a (SfAV-1a)

Uniprot NO.:Q0E558

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSHTERIGQTPKAYVLANERGPFSVEVYLNPGTSNTYQYVATTRSKFNATDYDDLPWNYT SGKKVITANGVVSGGDRYVFALRSEIPQDIQVTMYNVNNGVSSNMNVRQPSDNSYYQPPP PPPPPRLVYNNGELYDNMINDTGYATELGKKLNDNFKKLWDYVNQPIVWLGVSALVGYLI YRYYYMSRPIGFGNSGAYDVPLLDTPLLRDSYRLPQSFTRDPIFRNSI

Protein Names:Recommended name: Uncharacterized protein ORF43

Gene Names:ORF Names:ORF43

Expression Region:1-228

Sequence Info:full length protein

View full details