Skip to product information
1 of 1

Gene Bio Systems

Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF11(ORF11)

Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF11(ORF11)

SKU:CSB-CF801510SGAH

Regular price ¥251,400 JPY
Regular price Sale price ¥251,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spiroplasma virus SpV1-C74 (SpV1)

Uniprot NO.:Q88425

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIIEFNLLVILLVQMPLSFYMLYRLCYLLFCFLECFLNLFKKCGVFKNAKWLTRIQRVFY LYLFVYR

Protein Names:Recommended name: Uncharacterized protein ORF11

Gene Names:ORF Names:ORF11

Expression Region:1-67

Sequence Info:full length protein

View full details