Recombinant Sphingomonas wittichii UPF0391 membrane protein Swit_2334 (Swit_2334)

SKU: CSB-CF403072SUF

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

Uniprot NO.:A5V8S7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKWALIFLVVGLVLGALGFGGIGGAFVGLAKILFFIAIALFIVFALLALFAGKKISDSI

Protein Names:Recommended name: UPF0391 membrane protein Swit_2334

Gene Names:Ordered Locus Names:Swit_2334

Expression Region:1-60

Sequence Info:full length protein