Skip to product information
1 of 1

Gene Bio Systems

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D(CAB1D)

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D(CAB1D)

SKU:CSB-CF318777SZY

Regular price ¥225,700 JPY
Regular price Sale price ¥225,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Uniprot NO.:P10707

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 1D Alternative name(s): LHCII type I CAB-1D Short name= LHCP

Gene Names:Name:CAB1D

Expression Region:1-116

Sequence Info:full length protein

View full details