
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Uniprot NO.:P27489
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRW AMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGF QVVLMGLVEGFRINGLPGVGEGNDLYPGGQYFDPLGLADDPTTFAELKVKEIKNGRLAMF SMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGA
Protein Names:Recommended name: Chlorophyll a-b binding protein 13, chloroplastic Alternative name(s): LHCII type III CAB-13
Gene Names:Name:CAB13 Synonyms:LHBC1
Expression Region:43-265
Sequence Info:full length protein
You may also like
-
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1B, chloroplastic(CAB1B)
- Regular price
- ¥181,800 JPY
- Sale price
- ¥181,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3C, chloroplastic(CAB3C)
- Regular price
- ¥182,000 JPY
- Sale price
- ¥182,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3A, chloroplastic(CAB3A)
- Regular price
- ¥182,200 JPY
- Sale price
- ¥182,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic(CAB1A)
- Regular price
- ¥181,900 JPY
- Sale price
- ¥181,900 JPY
- Regular price
-
- Unit price
- per
Sold out