Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sodalis glossinidius UPF0756 membrane protein SG1722(SG1722)

Recombinant Sodalis glossinidius UPF0756 membrane protein SG1722(SG1722)

SKU:CSB-CF647575SBAA

Regular price ¥267,300 JPY
Regular price Sale price ¥267,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sodalis glossinidius (strain morsitans)

Uniprot NO.:Q2NS78

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSDPTLLILLGLAALGIISHNNIVTVAILVLLIIRLTPMEQYFPWVEKQGLTIGIIIL TIGVMAPIASGTLSASTVLHSFLHWKSLLAIVIGVAVSWLGGRGVSLMSSQPSVVAGLLV GTVLGVALFRGVPVGPLIAAGLLSLLVGNT

Protein Names:Recommended name: UPF0756 membrane protein SG1722

Gene Names:Ordered Locus Names:SG1722

Expression Region:1-150

Sequence Info:full length protein

View full details