Gene Bio Systems
Recombinant Shigella phage SfV Bactoprenol-linked glucose translocase(gtrA)
Recombinant Shigella phage SfV Bactoprenol-linked glucose translocase(gtrA)
SKU:CSB-CF519485SZE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella phage SfV (Shigella flexneri bacteriophage V) (Bacteriophage SfV)
Uniprot NO.:O22008
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVAVSFSFFANARFTFKA STTAMRYMLYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISLVCGFVYSKFIVFRDAK
Protein Names:Recommended name: Bactoprenol-linked glucose translocase Alternative name(s): Flippase
Gene Names:Name:gtrA Synonyms:26
Expression Region:1-120
Sequence Info:full length protein
