Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shigella boydii serotype 18 Electron transport complex protein RnfE(rnfE)

Recombinant Shigella boydii serotype 18 Electron transport complex protein RnfE(rnfE)

SKU:CSB-CF454904SYZ

Regular price ¥273,300 JPY
Regular price Sale price ¥273,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Uniprot NO.:B2U2D1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV

Protein Names:Recommended name: Electron transport complex protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:SbBS512_E1821

Expression Region:1-231

Sequence Info:full length protein

View full details