Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella putrefaciens UPF0114 protein Sputcn32_0673 (Sputcn32_0673)

Recombinant Shewanella putrefaciens UPF0114 protein Sputcn32_0673 (Sputcn32_0673)

SKU:CSB-CF397561STQ

Regular price ¥269,500 JPY
Regular price Sale price ¥269,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Uniprot NO.:A4Y370

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHVLPIIFEMREVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMNVENISNDKIMWYLLIHITFVLSAFAMGYLDKITRK

Protein Names:Recommended name: UPF0114 protein Sputcn32_0673

Gene Names:Ordered Locus Names:Sputcn32_0673

Expression Region:1-162

Sequence Info:full length protein

View full details