Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella denitrificans Na(+)-translocating NADH-quinone reductase subunit D(nqrD)

Recombinant Shewanella denitrificans Na(+)-translocating NADH-quinone reductase subunit D(nqrD)

SKU:CSB-CF614336SAAQ

Regular price ¥279,400 JPY
Regular price Sale price ¥279,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Uniprot NO.:Q12QK3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADVKELKQVLTGPIINNNPIALQILGVCSALAVTSKMETALVMSLALTVVTAFSNLFIS LIRNHIPSSVRIIVQMTIIASLVIVVDQVLQAYAYEIAKQLSVFVGLIITNCIVMGRAEA YAMKTPPMMSFMDGIGNGLGYGAILLGVGFFRELFGNGSLFGIEILSKISDGGWYQPNGL LLLPPSAFFLIGGLIWVIRTYKPEQVEAKG

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D

Gene Names:Name:nqrD Ordered Locus Names:Sden_0985

Expression Region:1-210

Sequence Info:full length protein

View full details