Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella amazonensis Electron transport complex protein RnfE(rnfE)

Recombinant Shewanella amazonensis Electron transport complex protein RnfE(rnfE)

SKU:CSB-CF376408STK

Regular price ¥282,000 JPY
Regular price Sale price ¥282,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Uniprot NO.:A1S6N4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNYKEIAWQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATVAVLIGSNVLVSLVR EFVPKEIRIPVFVMIIAALVTVVQLVINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS RNSVGAAAFDGLMMGTGFTAVLAVLGAVREILGQGTLFDGADQLLGDWAASLRIELWHVD NSFLLAMLPPGAFIAMGLLIAGKNVIDKRLEAKKPTPEAAPAITRARITKVG

Protein Names:Recommended name: Electron transport complex protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:Sama_1835

Expression Region:1-232

Sequence Info:full length protein

View full details