Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sheep Syntaxin-1B(STX1B)

Recombinant Sheep Syntaxin-1B(STX1B)

SKU:CSB-CF022896SH

Regular price ¥288,300 JPY
Regular price Sale price ¥288,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ovis aries (Sheep)

Uniprot NO.:P61268

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTTDIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL

Protein Names:Recommended name: Syntaxin-1B Alternative name(s): Syntaxin-1B2

Gene Names:Name:STX1B Synonyms:STX1B2

Expression Region:1-288

Sequence Info:full length protein

View full details