Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sheep Neuropeptide Y receptor type 2(NPY2R)

Recombinant Sheep Neuropeptide Y receptor type 2(NPY2R)

SKU:CSB-CF016036SH

Regular price ¥265,900 JPY
Regular price Sale price ¥265,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ovis aries (Sheep)

Uniprot NO.:P79211

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR

Protein Names:Recommended name: Neuropeptide Y receptor type 2 Short name= NPY2-R Alternative name(s): NPY-Y2 receptor Short name= Y2 receptor

Gene Names:Name:NPY2R

Expression Region:1-146

Sequence Info:Full length protein

View full details