Recombinant Sheep Interleukin-8(IL8)

Recombinant Sheep Interleukin-8(IL8)

CSB-EP011671SH
Regular price
¥125,700 JPY
Sale price
¥125,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P36925

Gene Names: IL8

Organism: Ovis aries (Sheep)

AA Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP

Expression Region: 23-101aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13.1 kDa

Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8

Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Reference: Sequencing of the ovine interleukin-8-encoding cDNA using the polymerase chain reaction.Legastelois I., Greenland T., Arnaud P., Mornex J.F., Cordier G.Gene 150:367-369(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share