
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: IL4
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Ovis aries (Sheep)
Delivery time: 3-7 business days
Uniprot ID: P30368
AA Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Expression Region: 25-135aa
Protein length: Full Length of Mature Protein
MW: 29.6 kDa
Alternative Name(s): B-cell stimulatory factor 1
Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.
Reference: "Cloning and sequencing an ovine interleukin-4-encoding cDNA."Seow H.F., Rothel J.S., Wood P.R.Gene 124:291-293(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Sheep Interleukin-4(IL4)
- Regular price
- ¥156,200 JPY
- Sale price
- ¥156,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sheep Interleukin-4(IL4)
- Regular price
- ¥171,400 JPY
- Sale price
- ¥171,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-4(IL-4)
- Regular price
- ¥103,900 JPY
- Sale price
- ¥103,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-4(IL4)
- Regular price
- ¥103,900 JPY
- Sale price
- ¥103,900 JPY
- Regular price
-
- Unit price
- per
Sold out