Recombinant Sheep Interleukin-4(IL4)

Recombinant Sheep Interleukin-4(IL4)

CSB-EP011659SH
Regular price
¥156,200 JPY
Sale price
¥156,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: IL4

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Ovis aries (Sheep)

Delivery time: 3-7 business days

Uniprot ID: P30368

AA Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Expression Region: 25-135aa

Protein length: Full Length of Mature Protein

MW: 29.6 kDa

Alternative Name(s): B-cell stimulatory factor 1

Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Reference: "Cloning and sequencing an ovine interleukin-4-encoding cDNA."Seow H.F., Rothel J.S., Wood P.R.Gene 124:291-293(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Sheep Interleukin-4(IL4)
    Regular price
    ¥156,200 JPY
    Sale price
    ¥156,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Sheep Interleukin-4(IL4)
    Regular price
    ¥171,400 JPY
    Sale price
    ¥171,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interleukin-4(IL-4)
    Regular price
    ¥103,900 JPY
    Sale price
    ¥103,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interleukin-4(IL4)
    Regular price
    ¥103,900 JPY
    Sale price
    ¥103,900 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share