Gene Bio Systems
Recombinant Sheep Antigen-presenting glycoprotein CD1d(CD1D)
Recombinant Sheep Antigen-presenting glycoprotein CD1d(CD1D)
SKU:CSB-CF004892SH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Ovis aries (Sheep)
Uniprot NO.:O62848
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SFEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESSTIRFLKHWSQGTFSDQQWEQLQHTFQVYRSSFTRDIREFVKMLPGDYPFEIQISGGCELLPRNISESFLRAALQEKDVLSFQGMSWVSAPDAPPWSQVVCKVLNEDQGTKETVHWLLHDICPELVKGLMQTGKSELEKQVKPEAWLSSGPSPGPDRLLLGCHVSGFYPKPVWVMWMRGEQEEPGTQQGDVMPNADSTWYLRVTLEVAAGEAAGLSCRVKHSSLGDQDIILYWDGKRVSRGLIVVLVILVFVLLFVGGLVFWFRKHRRYQDIS
Protein Names:Recommended name: Antigen-presenting glycoprotein CD1d Alternative name(s): CD_antigen= CD1d
Gene Names:Name:CD1D
Expression Region:18-335
Sequence Info:full length protein
