Skip to product information
1 of 1

Gene Bio Systems

Recombinant Serratia proteamaculans Fumarate reductase subunit C(frdC)

Recombinant Serratia proteamaculans Fumarate reductase subunit C(frdC)

SKU:CSB-CF421514STJ

Regular price ¥263,000 JPY
Regular price Sale price ¥263,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Serratia proteamaculans (strain 568)

Uniprot NO.:A8G8T5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTQRKPYVRTMTPTWWQKLGFYRFYMLREGTSVPAVWFSIVLIYGVFALKGGVDSWAGF VGFLQNPLVLLINFVALLAALLHTKTWFDLAPKAANIVVNSEKMGPGPIVKTLWAVTVVA SVVILAVALV

Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein

Gene Names:Name:frdC Ordered Locus Names:Spro_0417

Expression Region:1-130

Sequence Info:full length protein

View full details