Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sclerotinia sclerotiorum Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

Recombinant Sclerotinia sclerotiorum Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

SKU:CSB-CF409812STG

Regular price ¥279,500 JPY
Regular price Sale price ¥279,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)

Uniprot NO.:A7F679

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSNTPLPSSFDGDTDFYEENRWQKLTRRLKEEPLIPLGKSTHTLTLSPSPPSLHHPSTQ KLTHPLTHPPGCILTTLALVGATRSIRAGDHNRTQRMFRARIYAQGFTLLAMVAGSMYWD SDRKKRKEFEGVLAEQKAKEKNEAWIKELEARDEEEKEMRRMRDERRRRAEGKSAASGLV VDAANAGAEEGEKTKNGIVDQMKGMVWGKK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:aim31 ORF Names:SS1G_13108

Expression Region:1-210

Sequence Info:full length protein

View full details