Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe V-type proton ATPase subunit e(vma9)

Recombinant Schizosaccharomyces pombe V-type proton ATPase subunit e(vma9)

SKU:CSB-CF727966SXV

Regular price ¥251,200 JPY
Regular price Sale price ¥251,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q69Z14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGGLVVLLVGLLTALMSVVSYYVSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLE APSRVLE

Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Vacuolar proton pump subunit e

Gene Names:Name:vma9 ORF Names:SPBC1685.16

Expression Region:1-67

Sequence Info:full length protein

View full details