Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe UPF0382 membrane protein C1782.12c(SPAC1782.12c)

Recombinant Schizosaccharomyces pombe UPF0382 membrane protein C1782.12c(SPAC1782.12c)

SKU:CSB-CF873785SXV

Regular price ¥258,800 JPY
Regular price Sale price ¥258,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9P7G8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AYGSHGLQKRVQDPHLLKSWSTACTYLMFHSLATMAVSLHPVYGKSRWTGPLLITGSCLF SGTIYGLCLLPKGHSLRRILGPLTPIGGLVMLTGWATMLV

Protein Names:Recommended name: UPF0382 membrane protein C1782.12c

Gene Names:ORF Names:SPAC1782.12c

Expression Region:19-118

Sequence Info:full length protein

View full details