Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf12(wtf12)

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf12(wtf12)

SKU:CSB-CF854166SXV

Regular price ¥275,600 JPY
Regular price Sale price ¥275,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q8NIP8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNNYTSLKSSVDEEDELKTGHEIDLEKGPLPEHNSEGESTLPPYSDISKLANLVPEDSS TGPTETANPNVERRQEFKDLHPNIYSLLRLLIAVLAVSVVFFTAWGCVNPLEKSTFGKIA FFVLIGLTCLILLITMILEPGLIGISIMKRLIGDNGNDERDYFVENRLLSSPDCDARQHA NSDTAIPLREMNPESEA

Protein Names:Recommended name: Uncharacterized protein wtf12

Gene Names:Name:wtf12 ORF Names:SPCC1281.09, SPCC622.21

Expression Region:1-197

Sequence Info:full length protein

View full details