
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q1K9B6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LEIPISCAVSHNEQTEIFPHGTIDIPEMTFRPSDSQIDWSNLSHSDFVQCGVYEDSTNTW LAGASKYKIDEIKTLPKVPRDHYIILCDSSESNEIAKFTQVVHSFDFSSDSESAVVEQLH PSSPIPILTTAVRKKGSRPSKPQKEKQGNKQGSKTEESPNVDEDELESEPEEKTFFQKYG LYLIPILFLIIMSGNNANQQAANTAK
Protein Names:Recommended name: Uncharacterized protein C19D5.02c
Gene Names:ORF Names:SPAC19D5.02c
Expression Region:18-223
Sequence Info:full length protein
You may also like
-
Recombinant Schizosaccharomyces pombe Uncharacterized protein C19D5.10c(SPAC19D5.10c)
- Regular price
- ¥163,200 JPY
- Sale price
- ¥163,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.03c(SPCC191.03c)
- Regular price
- ¥166,800 JPY
- Sale price
- ¥166,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized protein C1002.01(SPAC1002.01, SPAC1610.05)
- Regular price
- ¥174,300 JPY
- Sale price
- ¥174,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C18E5.14c(SPBC18E5.14c)
- Regular price
- ¥186,200 JPY
- Sale price
- ¥186,200 JPY
- Regular price
-
- Unit price
- per
Sold out