Gene Bio Systems
Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 1, mitochondrial(cox1101)
Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 1, mitochondrial(cox1101)
SKU:CSB-CF891639SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q9UTM2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTIYYLVAISIFALGLTYAAVPLYRLFCSKTGYGGTLNTDQSRMNAERMVPRKDNKRIRV TFNGDVAGNLSWKLWPQQREIYVLPGETALGFYTAENTSDHDIVGVATYNIVPGQAAVYF SKVACFCFEEQKLDAHEKVDLPVFFFIDPEFADDPNMKDIDDILLSYTFFEARYDTNGNL LTKLN
Protein Names:Recommended name: Rsm22-cox11 tandem protein 1, mitochondrial Cleaved into the following 2 chains: 1. 37S ribosomal protein S22-1 EC= 2. 2.1.1.- 3. Cytochrome c oxidase assembly protein cox11-1
Gene Names:Name:cox1101 Synonyms:cox11, cox11-a ORF Names:SPAC1420.04c, SPAPB17E12.01c
Expression Region:569-753
Sequence Info:full length protein
