Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Protein YIP4(SPAC644.13c)

Recombinant Schizosaccharomyces pombe Protein YIP4(SPAC644.13c)

SKU:CSB-CF889220SXV

Regular price ¥280,800 JPY
Regular price Sale price ¥280,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9P6P8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDIGKHNTEIEQDEMENLLRMDPVRSSLDVESRAIEPDNIAGESIVETRFTGGDSLDEP IRVTLFNEFRAIGEKLVYVLYPKNAQVLRDWDLWGPLIFSLVIALALALSTDKIERESVF TVVVALIWFGEAVCSLNIKLLGANISIFQSMCILGYSSFPLMIASIVCAFVPLIFIRIPV IVAMYAWTLFAAMGVLQNSNLSNKKLLAVYPLFLFYFSLAWIIFL

Protein Names:Recommended name: Protein YIP4 Alternative name(s): YPT-interacting protein 4

Gene Names:ORF Names:SPAC644.13c

Expression Region:1-225

Sequence Info:full length protein

View full details