Recombinant Schizosaccharomyces pombe Protein transport protein sec61 subunit beta(sbh1)

SKU: CSB-CF020958SXV

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O43002

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSTKASGSVKNSAASAPGGPKSQIRRRAAVEKNTKESNSGPAGARAAGAPGSTPTLLKLYTDEASGFKVDPVVVMVLSVGFIASVFLLHIVARILKKFASE

Protein Names:Recommended name: Protein transport protein sec61 subunit beta

Gene Names:Name:sbh1 ORF Names:SPBC2G2.03c

Expression Region:1-102

Sequence Info:full length protein