Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim23(tim23)

Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim23(tim23)

SKU:CSB-CF892010SXV

Regular price ¥241,200 JPY
Regular price Sale price ¥241,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9USM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSWLFTRNKEEEPTSKIDSSELQVPTEATASDILSGSEFDPAKLHPLADLDKPLDYLLIE EDALSTLPGDSMAIPSRGWQDDLCYGTGTSYLSGLAIGGLWGLNEGMKKTKDITSTRLRL NGILNGVTRRGPFVGNSLGVLALVYNGINSLIGYKRQKHGWENSVAAGALTGALYKSTRG LRAMAISSSLVATAAGIWTLAKRSFTKRLN

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim23

Gene Names:Name:tim23 ORF Names:SPCC16A11.09c

Expression Region:1-210

Sequence Info:full length protein

View full details