Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim21(tim21)

Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim21(tim21)

SKU:CSB-CF527241SXV

Regular price ¥276,700 JPY
Regular price Sale price ¥276,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O94618

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SLASDSLNKQRKPQEEGRLARIFKDPSNKAWKDLTAPQKAYRTSANIGNFSIVIFGGGVF GLIIYALVTSIWKGEAHYGDEAFELLKANEECRYVFGDHMKALGEATHPLRRTHGILTSR VWDHHGVEHLVLQFHLIGNERKGHVFGRLVNVQGDYKWEYLFVDVANYGKIIIFDHTNSV RQQHKNFGLWGSLKNITWGN

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim21

Gene Names:Name:tim21 ORF Names:SPBC1289.09

Expression Region:24-223

Sequence Info:full length protein

View full details