Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Gamma-glutamyltranspeptidase 2(ggt2)

Recombinant Schizosaccharomyces pombe Gamma-glutamyltranspeptidase 2(ggt2)

SKU:CSB-CF009395SXV

Regular price ¥312,900 JPY
Regular price Sale price ¥312,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O14194

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPTDTTPLLYSWDDQSRHQDPDWHKLRNYHGAWYRRISRRRFSQFIFAFGLMTLFVLVYSISSNLHTPTQFTGHKVRGRRGAVASEVPVCSDIGVSMLADGGNAVDAAIASTFCIGVVNFFSSGIGGGGFMLIKHPNETAQSLTFREIAPGNVSKHMFDKNPMLAQVGPLSIAIPGELAGLYEAWKSHGLLDWSKLLEPNVKLAREGFPVTRAMERVLKLPEMAHLLKDPIWQPILMPNGKVLRAGDKMFRPAYAKTLEIIANKGIEPFYRGELTNSMVKFIQDNGGIVTVEDFGNYSTVFADALHTSYRGHDVYTCTLPTSGPALIEGLNILDGYPLNTPSLAFPKRLHLEVEAMKWLSAGRTQFGDPDFLPLDHLDVVSKLLSKEFASQIRNNISLSKTYPWEHYNPSYDLPISHG

Protein Names:Recommended name: Gamma-glutamyltranspeptidase 2 EC= 2.3.2.2 Alternative name(s): Gamma-glutamyltransferase 2 Glutathione hydrolase 2 EC= 3.4.19.13 Cleaved into the following 2 chains: 1. Gamma-glutamyltranspeptidase 2 heavy chain 2. Gamma-glutamyltranspeptidase 2 light chain

Gene Names:Name:ggt2 ORF Names:SPAC56E4.06c

Expression Region:1-419

Sequence Info:full length protein

View full details