Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 10(qcr10)

Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 10(qcr10)

SKU:CSB-CF889232SXV

Regular price ¥253,800 JPY
Regular price Sale price ¥253,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9P7E0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISFFPNKPMYHVQPHISFITPERTMKTIPAFSRWAFAAVAGVFVFAMQVPKVKTTILQP IAFIGDHFKDKTPEEDKWL

Protein Names:Recommended name: Cytochrome b-c1 complex subunit 10 Alternative name(s): Complex III subunit 10 Ubiquinol-cytochrome-c reductase complex subunit qcr10

Gene Names:Name:qcr10 ORF Names:SPBP4H10.08

Expression Region:1-79

Sequence Info:full length protein

View full details