Gene Bio Systems
Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme
Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme
SKU:CSB-YP357414SXP
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P08515
Gene Names:N/A
Organism:Schistosoma japonicum (Blood fluke)
AA Sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLERPHRD
Expression Region:2-218aa
Sequence Info:Full Length of Mature Protein
Source:Yeast
Tag Info:N-terminal 6xHis-tagged
MW:30.4 kDa
Alternative Name(s):Sj26 antigen (SjGST) (GST 26)
Relevance:Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.
Reference:"Insights into dynein motor domain function from a 3.3-A crystal structure." Schmidt H., Gleave E.S., Carter A.P. Nat. Struct. Mol. Biol. 19:492-497(2012)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.; FUNCTION
Involvement in disease:
Subcellular Location:
Protein Families:GST superfamily, Mu family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
