Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schistosoma japonicum 25 kDa integral membrane protein

Recombinant Schistosoma japonicum 25 kDa integral membrane protein

SKU:CSB-CF310486SXP

Regular price ¥276,200 JPY
Regular price Sale price ¥276,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schistosoma japonicum (Blood fluke)

Uniprot NO.:P91799

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLSFTKVSLTNILILFNCLFIIFSMIVLTFGVIPQIYLLKFANILHGVRPSIFPIVCFT GSFVIIVACVGIIGLMKGGKCLLTMHIIALIIATIIDISTATLSAIKQNEFLTKAGQVLN DSSKLYYKNRLYATEFDLMHITFKCCNVKNDYSLLGTLHLIPESCTHGIEFYKQQCNEPL NKYVRYYIDILIYLCFIFGFIKLIYSLFTFTQRQRIFSEKTPVA

Protein Names:Recommended name: 25 kDa integral membrane protein Alternative name(s): Sj25 Sj25/TM4

Gene Names:

Expression Region:1-224

Sequence Info:full length protein

View full details