Skip to product information
1 of 1

Gene Bio Systems

Recombinant Scheffersomyces stipitis Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Recombinant Scheffersomyces stipitis Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

SKU:CSB-CF025866SXM

Regular price ¥253,800 JPY
Regular price Sale price ¥253,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Uniprot NO.:A3LU53

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAEIPTSVIQKLVFFTGAMIIFPIFTFFVCQYLFSNNALISGGIAALMANVVLIGYVVV AFTEDTSSLADEKVETKKDI

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:VMA21 ORF Names:PICST_58812

Expression Region:1-80

Sequence Info:full length protein

View full details