Skip to product information
1 of 1

Gene Bio Systems

Recombinant Scheffersomyces stipitis Golgi apparatus membrane protein TVP18(TVP18)

Recombinant Scheffersomyces stipitis Golgi apparatus membrane protein TVP18(TVP18)

SKU:CSB-CF386483SXM

Regular price ¥272,500 JPY
Regular price Sale price ¥272,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Uniprot NO.:A3LPS1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFSIQSIFSNIFSGLSADFKKKNFSLYGQWVGIISILLCLALGVANIFHASIVIVFSII CIVQGLVVTLVEMPFLLKICPFTETFTNFIKNFDANWPRCGFYLLNAAIQWVSIAVMATS LIVVACFFTVAGGCYALAAITHQEYLKSSIQVTGSPDSVEGQIGQHVVRNVL

Protein Names:Recommended name: Golgi apparatus membrane protein TVP18

Gene Names:Name:TVP18 ORF Names:PICST_35158

Expression Region:1-172

Sequence Info:full length protein

View full details