Gene Bio Systems
Recombinant Scheffersomyces stipitis Golgi apparatus membrane protein TVP18(TVP18)
Recombinant Scheffersomyces stipitis Golgi apparatus membrane protein TVP18(TVP18)
SKU:CSB-CF386483SXM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Uniprot NO.:A3LPS1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFSIQSIFSNIFSGLSADFKKKNFSLYGQWVGIISILLCLALGVANIFHASIVIVFSII CIVQGLVVTLVEMPFLLKICPFTETFTNFIKNFDANWPRCGFYLLNAAIQWVSIAVMATS LIVVACFFTVAGGCYALAAITHQEYLKSSIQVTGSPDSVEGQIGQHVVRNVL
Protein Names:Recommended name: Golgi apparatus membrane protein TVP18
Gene Names:Name:TVP18 ORF Names:PICST_35158
Expression Region:1-172
Sequence Info:full length protein
