Gene Bio Systems
Recombinant Salmonella typhimurium Uncharacterized protein yebO(yebO)
Recombinant Salmonella typhimurium Uncharacterized protein yebO(yebO)
SKU:CSB-CF353719SXB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Uniprot NO.:P64501
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNDVLNSGAFSLASLIVSMVVLVVGLALWFFVNRASSRANEQIELLEALLDQQKRQNALL RRLCEANEPEKEAEPATAASEPKEDEDIIRLVAER
Protein Names:Recommended name: Uncharacterized protein yebO
Gene Names:Name:yebO Ordered Locus Names:STM1839
Expression Region:1-95
Sequence Info:full length protein
